| Name | TFPI2 Human |
|---|---|
| Supplier | NeoScientific |
| Catalog | PRPS-867 |
| Category | Protein |
| Prices | $637.00 |
| Sizes | 10 µg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Nicotiana benthamiana |
| Purity | Greater than 97.0% as determined by SDS-PAGE. |
| Bioactivity | The activity of the TFPI2 is expressed as the amount of trypsin inhibited per milligram of TFPI2. The ability to prevent the hydrolysis of benzoyl-Larginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. 1mg TFPI2 protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein. |
| Gene | TFPI2 |
| Sequence | HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRYTQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV. |
| Description | TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques. |
| Supplier Page | Shop |