| Name | Urocortin III Peptide |
|---|---|
| Supplier | ABBIOTEC |
| Catalog | 350416 |
| Category | Peptide |
| Prices | $391.00 |
| Sizes | 1 mg |
| Purity | Purity > 95% by HPLC |
| Gene | UCN3 |
| Sequence | Human: H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 or H-FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2 |
| Description | Urocortin III decreases food intake and delays gastric emptying activity. Stresscopin is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2), therefore acts as the endogenous ligand for maintaining homeostasis after stress. Urocortin III corresponds to Stresscopin [3-40]. |
| Supplier Page | Shop |