Stresscopin Peptide

• Supplier: ABBIOTEC
• Catalog: 350392
• Category: Peptide
• Prices: $257.00
• Sizes: 1 mg
• Purity: Purity > 95% by HPLC
• Gene: UCN3
• Sequence: Human: H-Thr-Lys-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Leu-Leu-Phe-Asn-Ile-Ala-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Gln-Ala-Ala-Ala-Asn-Ala-His-Leu-Met-Ala-Gln-Ile-NH2 or H-TKFTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI-NH2
• Description: Stresscopin decreases food intake and delays gastric emptying activity. Stresscopin is a specific ligand for the corticotropin-releasing hormone receptor type 2 (CRHR2), therefore acts as the endogenous ligand for maintaining homeostasis after stress.