| Name | PACAP [1-38] Peptide |
|---|---|
| Supplier | ABBIOTEC |
| Catalog | 350319 |
| Category | Peptide |
| Prices | $346.00 |
| Sizes | 1 mg |
| Purity | Purity > 95% by HPLC |
| Gene | ADCYAP1 |
| Sequence | Human, Ovine, Rat: H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 or H-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
| Description | Pituitary adenylate cyclase-activating polypeptide (PACAP) is a 19-kDa prohormone processed into PACAP-related peptide (PRP-48), PACAP-27 and PACAP-38. PACAP stimulates adenylate cyclase in pituitary cells, playing pivotal roles as neurotransmitter and neuromodulator. PACAP belongs to the glucagon family. |
| Supplier Page | Shop |