Human Uteroglobin full length protein
| Name | Human Uteroglobin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab112370 |
| Category | Protein |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Bioactivity | useful for Antibody Production and Protein Array |
| SwissProt/Accession | P11684 |
| Gene | SCGB1A1 |
| Residue | 22 to 91 |
| Sequence | EICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLPQ KPRESIIKLMEKIAQSSLCN |
| Supplier Page | Shop |
Product images
ab112370 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.