ACTH [1-39] Peptide (Rat)

Name ACTH [1-39] Peptide (Rat)
Supplier ABBIOTEC
Catalog 350025
Category Peptide
Prices $212.00
Sizes 1 mg
Species Reactivities Rat
Purity Purity > 95% by HPLC
Gene Pomc
Sequence Rat: H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Val-Ala-Glu-Asn-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH or H-SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF-OH
Description Adrenocorticotropic hormone (ACTH), also known as corticotropin, is produced and secreted by the anterior pituitary gland. ACTH is an important component of the hypothalamic-pituitary-adrenal axis as a response to biological stress. ACTH secretion is triggered by the corticotropin-releasing hormone (CRH) released from the hypothalamus, and stimulates the adrenal glands to release corticosteroids such as cortisol. ACTH [1-39] corresponds to full-length ACTH. ACTH [1-24] is conserved across species and is 75% as potent as ACTH. ACTH [1-10] has no ACTH activity but alter blood pressure. ACTH [4-10] has neurological effects.
Supplier Page Shop