Active mouse IL2 full length protein

Name Active mouse IL2 full length protein
Supplier Abcam
Catalog ab191630
Category Protein
Prices $192.00
Sizes 20 µg
Applications FA SDS-PAGE
Species Reactivities Mouse
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 as determined by the dose dependent stimulation of murine CTLL-2 cells is < 0.1 ng/ml, corresponding to a specific activity of > 1 x 10 7 units/mg.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P60568
Gene IL2
Residue 21 to 169
Sequence APTSSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKL PRMLTFKFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENF ISNIRVTVVKLKGSDNTFECQFDDESATVVDFLRRWIAFCQSIISTSPQ
Supplier Page Shop