| Name | Active mouse IL3 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab200268 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 2 µg |
| Applications | HPLC FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. ab200268 is >98% pure as assessed by SDS-PAGE and HPLC analyses. |
| Bioactivity | The ED 50 as determined by the dose-dependent stimulation of the proliferation ofmurine M-NFS-60 cells is < 0.05 ng/ml, corresponding to a specific activity of > 2 x10 7 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P08700 |
| Gene | IL3 |
| Residue | 33 to 166 |
| Sequence | MDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKF VESQGEVDPEDRYVIKSNLQLNCCLPTSANDSALPGVFIRDLDDFRKKLR FYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC |
| Supplier Page | Shop |