| Name | Active mouse IL4 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191628 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by the dose-dependent stimulation of the proliferation of Human TF-1 cells as ≤ 0.4 ng/mL, corresponding to a specific activity of ≥ 2.0 x 10 6 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P05112 |
| Gene | IL4 |
| Residue | 21 to 140 |
| Sequence | HIHGCDKNHLREIIGILNEVTGEGTPCTEMDVPNVLTATKNTTESELVCR ASKVLRIFYLKHGKTPCLKKNSSVLMELQRLFRAFRCLDSSISCTMNESK STSLKDFLESLKSIMQMDYS |
| Supplier Page | Shop |