Active mouse IL6 full length protein

Name Active mouse IL6 full length protein
Supplier Abcam
Catalog ab201439
Category Protein
Prices $101.00
Sizes 2 µg
Applications FA SDS-PAGE HPLC
Species Reactivities Mouse
Nature Recombinant
Source E. coli
Purity > 97 % by SDS-PAGE. Purity is determined by SDS-PAGE and HPLC analyses.
Bioactivity Fully biologically active when compared to standard. The ED 50 as determined by the dose-dependent stimulation of the proliferation of IL6-dependent murine 7TD1 cells is < 0.02 ng/mL, corresponding to a specific activity of > 5 x 10 7 units/mg.
SwissProt/Accession P05231
Gene IL6
Residue 25 to 211
Sequence FPTSQVRRGDFTEDTTPNRPVYTTSQVGGLITHVLWEIVEMRKELCNGNS DCMNNDDALAENNLKLPEIQRNDGCYQTGYNQEICLLKISSGLLEYHSYL EYMKNNLKDNKKDKARVLQRDTETLIHIFNQEVKDLHKIVLPTPISNALL TDKLESQKEWLRTKTIQFILKSLEEFLKVTLRSTRQT
Supplier Page Shop