| Name | Active mouse IL7 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab181948 |
| Category | Protein |
| Prices | $1,166.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. |
| Bioactivity | The ED 50 of this protein, as measured by 2E8 cell proliferation assay, is less than or equal to 1.6 ng/ml. This corresponds to a specific activity of greater than or equal to 6.3 x 10 5 Units/mg. |
| SwissProt/Accession | P13232 |
| Gene | IL7 |
| Residue | 26 to 154 |
| Sequence | ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTK EAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVK EQKKNDACFLKRLLREIKTCWNKILKGSI |
| Supplier Page | Shop |