| Name | Active mouse Interferon gamma full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab181946 |
| Category | Protein |
| Prices | $396.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. |
| Bioactivity | The ED 50 of this protein, as measured by EMC virus protection assay with L929 cells, is less than or equal to 175 pg/ml. This corresponds to a specific activity of greater than or equal to 5.7 x 10 6 Units/mg. |
| SwissProt/Accession | P01579 |
| Gene | IFNG |
| Residue | 23 to 155 |
| Sequence | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIIS FYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVN NPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
| Supplier Page | Shop |