| Name | Active mouse Interferon gamma full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab192111 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 100 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The ED 50 was determined by a viral resistance assay of mouse L929 cells and was found to be ≤ 1.0 ng/mL, corresponding to a specific activity of ≥ 1.0 x 10 6 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01579 |
| Gene | IFNG |
| Residue | 23 to 155 |
| Sequence | HGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIIS FYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVN NPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC |
| Supplier Page | Shop |