| Name | Active HIV protease full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab84117 |
| Category | Protein |
| Prices | $275.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 95 % by SDS-PAGE. Purified by an affinity chromatography in combination with FPLC chromatography |
| Bioactivity | One unit of HIV Protease hydrolyzes 1 picomole of a peptide (SQNYPIVQ) per minute at pH 4.7 at 25oC. 20-200ng is sufficient for an in vitro protease assay. HIV Protease can be applied in in vitro assay development and screening of protease inhibitors. |
| Gene | ERVK-10 |
| Residue | 1 to 99 |
| Sequence | PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGI GGFIKVRQYDQILIEICGHK |
| Supplier Page | Shop |