Recombinant Human VAMP Associated Protein A 33kDa

• Supplier: Genway Biotech
• Catalog: GWB-A09F5A
• Category: Protein
• Prices: $75.00, $165.00, $2,685.00
• Sizes: 5 μg, 20 μg, 1000 μg
• Species Reactivities: Human
• Nature: Recombinant
• Purity: Greater than 85% as determined by SDS-PAGE.
• SwissProt/Accession: Q9P0L0
• Gene: VAPA
• Sequence: RGSHHHHHHGM A SMTGGQQMGRDLYDDDDKDRWGSHM A S A SG A M A KH E QILVLDPPTDLKFKGPFTDVVTTNLKLRNPSDRKVCFKVKTT A PRRYCVRPNSGIIDPGSTVTVSVMLQPFDYDPN E KSKHKFMVQTIF A PPNTSDM E A VWK E A KPD E LMDSKLRCVF E MPN E NDKLNDM E PSK A VPLN A SKQDGPMPKPHSVSLNDT E TRKLM E E CKRLQG E MMKLS E E NRHLRD E GLRLRKV A HSDKPGSTST A SFRDNVTSP. Introduction: VAPA is involved in vesicle traficking. VAPA is a type IV membrane protein. It is localized in the plasma membrane and intracellular vesicles. VAPA is related with the cytoskeleton. VAPA functions membrane fusion, protein complex assembly and cell motility. VAPA is an essential regulator both of the subcellular localization of protrudin and of its ability to stimulate neurite outgrowth.Description: VAPA Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 264 amino acids (1-227 a.a.) and having a molecular mass of 29.8 kDa. VAPA is fused to 37 amino acid His Tag and purified by proprietary chromatographic techniques.
• Description: Recombinant Human VAMP Associated Protein A, 33kDa