| Name | Recombinant Human Quinone Oxidoreductase-like Protein 1 |
|---|---|
| Supplier | Genway Biotech |
| Catalog | GWB-37AF7D |
| Category | Protein |
| Prices | $75.00, $165.00, $2,685.00 |
| Sizes | 5 μg, 20 μg, 1000 μg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| SwissProt/Accession | O95825 |
| Gene | CRYZL1 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMKGLYFQQSSTD E E ITFVFQ E K E DLPVT E DNFVKLQVK A C A LSQINTKLL A E MKMKKDLFPVGR E I A GIVLDVGSKVSFFQPDD E VVGILPLDS E DPGLC E VVRVH E HYLVHKP E KVTWT E A A GSIRDGVR A YT A LHYLSHLSPGKSVLIMDG A S A FGTI A IQL A HHRG A KVIST A CSL E DKQCL E RFRPPI A RVIDVSNGKVHV A E SCL E E TGGLGVDIVLD A GVRLYSKDD E P A VKLQLLPHKHDIITLLGVGGHWVTT E E NLQLDPPDSHCLFLKG A TL A FLND E VWNLSNVQQGKYLCILKDVM E KLSTGVFRPQLD E PIPLY E A KVSM E A VQKNQGRKKQVVQF. Introduction: Quinone Oxidoreductase (CRYZL1) is a protein that has sequence similarity to zeta crystalline. CRYZL1 has NADPH-dependent quinone reductase activity distinct from other known quinone reductases, and may have a role as a pH response element-binding protein. CRYZL1 contains an NAD(P)H binding site. CRYZL1 is expressed at different levels in the heart, brain, skeletal muscle, kidney, pancreas, liver and lung. CRYZL1 is present at low levels in human lens tissue.Description: CRYZL1 Human Recombinant produced in E.Coli is a sin |
| Description | Recombinant Human Quinone Oxidoreductase-like Protein 1 |
| Supplier Page | Shop |