Recombinant Human Surfeit-1

• Supplier: Genway Biotech
• Catalog: GWB-5EA620
• Category: Protein
• Prices: $75.00, $165.00, $2,685.00
• Sizes: 5 μg, 20 μg, 1000 μg
• Species Reactivities: Human
• Nature: Recombinant
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• SwissProt/Accession: Q15526
• Gene: SURF1
• Sequence: MGSSHHHHHHSSGLVPRGSHMQVQRRKWKLNLI A E L E SRVL A E PVPLP A DPM E LKNL E YRPVKVRGCFDHSK E LYMMPRTMVDPVR E A R E GGLISSSTQSG A YVVTPFHCTDLGVTILVNRGFVPRKKVNP E TRQKGQI E G E VDLIGMVRLT E TRQPFVP E NNP E RNHWHYRDL E A M A RITG A E PIFID A NFQSTVPGGPIGGQTRVTLRN E HLQ. Introduction: SURF1 plays a role in the biogenesis of the COX complex. SURF1 is found in the inner mitochondrial membrane and takes part in the biogenesis of the cytochrome c oxidase complex. SURF1 is shares a bidirectional promoter with SURF2 on the opposite strand. Defects in this SURF1 cause Leigh syndrome, a rigorous neurological disorder that is generally associated with systemic cytochrome c oxidase deficiency.Description: Surfeit-1 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 215 amino acids (80-273 a.a.) and having a molecular mass of 24.3 kDa. The Surfeit-1 is fused to a 20 amino acid His Tag at N-terminus and purified by proprietary chromatographic techniques.
• Description: Recombinant Human Surfeit-1