Active mouse MCP5 full length protein

Name Active mouse MCP5 full length protein
Supplier Abcam
Catalog ab191747
Category Protein
Prices $192.00
Sizes 25 µg
Applications FA SDS-PAGE
Species Reactivities Mouse
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity Determined by its ability to chemoattract Human monocytes using a concentration range of 20-40 ng/ml.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession Q62401
Gene Ccl12
Residue 23 to 104
Sequence GPDAVSTPVTCCYNVVKQKIHVRKLKSYRRITSSQCPREAVIFRTILDKE ICADPKEKWVKNSINHLDKTSQTFILEPSCLG
Supplier Page Shop