| Name | Active mouse SDF1 beta full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191672 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Determined by its ability to chemoattract Human peripheral T cells activated with PHA and IL2 using a concentration range of 5.0-40 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P48061 |
| Gene | CXCL12 |
| Residue | 22 to 93 |
| Sequence | KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVC IDPKLKWIQEYLEKALNKRLKM |
| Supplier Page | Shop |