| Name | Active mouse TECK full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab201368 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 5 µg |
| Applications | FA HPLC SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . >95% by HPLC analysis. |
| Bioactivity | Fully biologically active when compared to standard. The ED 50 determined by a chemotaxis bioassay using Human CCR9 transfected BaF3 murine proB cells is less than 500 ng/ml, corresponding to a specific activity of >2×10 3 IU/mg. |
| SwissProt/Accession | O15444 |
| Gene | CCL25 |
| Residue | 24 to 144 |
| Sequence | QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVC GNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNST SVRSATLGHPRMVMMPRKTNN |
| Supplier Page | Shop |