Recombinant Human C1QTNF9, His-tagged

Name Recombinant Human C1QTNF9, His-tagged
Supplier Creative Biomart
Catalog C1QTNF9-26127TH
Category Protein
Nature Recombinant
Source E. coli
Purity >90% by SDS-PAGE
SwissProt/Accession P0C862
Gene C1QTNF9
Sequence ETLVLPKSAFTVGLTVLSKFPSSDMPIKFDKILYNEFNHYDTAAGKFTCHIAGVYYFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGDEVWLQVTGGERFNGLFADEDDDTTFTGFLLFSSP
Description Recombinant fragment from the globular domain of Human C1QTNF9 corresponding to amino acids 195-333 (139 aas) with a N terminal His-tag; predicted MWt: 16 kDa.
Supplier Page Shop