Recombinant Human C4B

Name Recombinant Human C4B
Supplier Creative Biomart
Catalog C4B-27789TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P0C0L5
Gene C4B
Sequence NNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKVLRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTPLQLFEG
Description Recombinant fragment corresponding to amino acids 1347-1446 of Human C4b with a proprietary tag; predicted MWt 36.63kDa inclusive of tag.
Supplier Page Shop