Recombinant Human CAPN3

Name Recombinant Human CAPN3
Supplier Creative Biomart
Catalog CAPN3-27402TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P20807
Gene CAPN3
Sequence NKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFDSFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
Description Recombinant fragment of Human Calpain 3 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
Supplier Page Shop