Recombinant Human CDC26, His-tagged

Name Recombinant Human CDC26, His-tagged
Supplier Creative Biomart
Catalog CDC26-27901TH
Category Protein
Nature Recombinant
Source E. coli
Purity >90% by SDS-PAGE
SwissProt/Accession Q8NHZ8
Gene CDC26
Sequence MGSSHHHHHHSSGLVPRGSHMLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEF
Description Recombinant full length Human Cdc26 / Apc12 with an N terminal His tag; 105 amino acids with tag, MWt 11.9 kDa.
Supplier Page Shop