Recombinant Human CDH8

Name Recombinant Human CDH8
Supplier Creative Biomart
Catalog CDH8-26742TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P55286
Gene CDH8
Sequence KDDPKNGHYFLYSLLPEMVNNPNFTIKKNEDNSLSILAKHNGFNRQKQEVYLLPIIISDSGNPPLSSTSTLTIRVCGCSNDGVVQSCNVEAYVLPIGLSM
Description Recombinant fragment (amino acids 522-621) of Human Cadherin 8 with proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag.
Supplier Page Shop