Mouse PDGF AA full length protein
| Name | Mouse PDGF AA full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167750 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . ab167750 was lyophilized from 0.22 µm filtered solution. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P04085 |
| Gene | PDGFA |
| Residue | 87 to 196 |
| Sequence | SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTS SVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNP DHREEETGRR |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab167750 staining overnight with Coomassie Blue. DTT-reduced (+) protein migrates as a 16.5 kDa polypeptide and the non-reduced (-) cystine-linked homodimer migrates as a 28 kDa protein (6µg).