Recombinant Human CST6, His-tagged

Name Recombinant Human CST6, His-tagged
Supplier Creative Biomart
Catalog CST6-26432TH
Category Protein
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE
SwissProt/Accession Q15828
Gene CST6
Sequence MGSSHHHHHHSSGLVPRGSHMRPQERMVGELRDLSPDDPQVQKAAQAAVASYNMGSNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKHNCVQM
Description Recombinant full length Human CST6 with an N terminal His tag; 142 amino acids with tag, MWt 15.9 kDa.
Supplier Page Shop