Name | Recombinant Human CYP2A6 |
---|---|
Supplier | Creative Biomart |
Catalog | CYP2A6-27019TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P11509 |
Gene | CYP2A6 |
Sequence | LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR |
Description | Recombinant fragment corresponding to amino acids 395-494 of Human Cytochrome P450 2A6 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
Supplier Page | Shop |