Recombinant Human CYP2A6

Name Recombinant Human CYP2A6
Supplier Creative Biomart
Catalog CYP2A6-27019TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P11509
Gene CYP2A6
Sequence LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR
Description Recombinant fragment corresponding to amino acids 395-494 of Human Cytochrome P450 2A6 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
Supplier Page Shop