| Name | Recombinant Human DECR1, GST-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | DECR1-973H |
| Category | Protein |
| Applications | ELISA WB Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | wheat germ |
| SwissProt/Accession | Q16698 |
| Gene | DECR1 |
| Sequence | NVIQPGPIKTKGAFSRLDPTGTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTIEELIRKTKGS |
| Description | Recombinant human DECR1 with gst tag atN-terminal was produced in wheat germ expressionsystem in vitro and purified by Glutathione Sepharose 4 Fast Flow, 36.74 kDa(236 a.a |
| Supplier Page | Shop |