| Name | Recombinant Human DEFA1, GST-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | DEFA1-2155H |
| Category | Protein |
| Applications | ELISA WB Array |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P59665 |
| Gene | DEFA1 |
| Sequence | MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKSMDCYCRIPACIAGERRYGTCIYQGRLWAFCC |
| Description | RecombinantHuman protein DEFA1 with GST-tag at N-terminal was produced in wheat germ expressionsystem in vitro and purified by GlutathioneSepharose 4 Fast Flow, 36.08 KDa. |
| Supplier Page | Shop |