Recombinant Human DVL3

Name Recombinant Human DVL3
Supplier Creative Biomart
Catalog DVL3-28354TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q92997
Gene DVL3
Sequence MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP*
Description Recombinant fragment of Human Dishevelled 3 with a N terminal proprietary tag: predicted molecular weight 36.63 kDa inclusive of tag.
Supplier Page Shop