Recombinant Human EGR1

Name Recombinant Human EGR1
Supplier Creative Biomart
Catalog EGR1-28467TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P18146
Gene EGR1
Sequence SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Description Recombinant fragment correponding to amino acids 444-543 of Human Egr1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop