Recombinant Human EGR2

Name Recombinant Human EGR2
Supplier Creative Biomart
Catalog EGR2-28469TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P11161
Gene EGR2
Sequence PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
Description Recombinant fragment corresponding to amino acids 217-293 of Human EGR2 with an N terminal proprietary tag; Predicted MWt 34.10 kDa.
Supplier Page Shop