Active rat Eotaxin full length protein

Name Active rat Eotaxin full length protein
Supplier Abcam
Catalog ab192106
Category Protein
Prices $192.00
Sizes 20 µg
Applications SDS-PAGE FA
Species Reactivities Rat
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity Activity was determined by the ability to chemoattract Human peripheral blood eosinophils using a concentration range of 0.1-20 ng/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P51671
Gene CCL11
Residue 27 to 97
Sequence HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEIC ADPKKKWVQDATKHLDQKLQTPKP
Supplier Page Shop