| Name | Recombinant Human EIF3K, His-tagged |
|---|---|
| Supplier | Creative Biomart |
| Catalog | EIF3K-27408TH |
| Category | Protein |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >90% by SDS-PAGE |
| SwissProt/Accession | Q9UBQ5 |
| Gene | EIF3K |
| Sequence | VLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQ |
| Description | Recombinant fragment: VLKLYQFNPA FFQTTVTAQI LLKALTNLPH TDFTLCKCMI DQAHQ, corresponding to amino acids 50-94 of Human eIF3K fused to a His tag at N-terminal end, 10kDa. |
| Supplier Page | Shop |