Recombinant Human ENO3

Name Recombinant Human ENO3
Supplier Creative Biomart
Catalog ENO3-28564TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P13929
Gene ENO3
Sequence KTAIQAAGYPDKVVIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLG
Description Recombinant fragment corresponding to amino acids 228-277 of Human ENO3 with an N terminal proprietary tag; Predicted MWt 31.13 kDa.
Supplier Page Shop