Recombinant Human ERCC3

Name Recombinant Human ERCC3
Supplier Creative Biomart
Catalog ERCC3-30703TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P19447
Gene ERCC3
Sequence APGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVS
Description Recombinant fragment corresponding to amino acdis 29-128 of Human XPB with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusive of tag
Supplier Page Shop