Name | Recombinant Human ERCC3 |
---|---|
Supplier | Creative Biomart |
Catalog | ERCC3-30703TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P19447 |
Gene | ERCC3 |
Sequence | APGNDPQEAVPSAAGKQVDESGTKVDEYGAKDYRLQMPLKDDHTSRPLWVAPDGHIFLEAFSPVYKYAQDFLVAIAEPVCRPTHVHEYKLTAYSLYAAVS |
Description | Recombinant fragment corresponding to amino acdis 29-128 of Human XPB with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusive of tag |
Supplier Page | Shop |