Recombinant Human ETV1

Name Recombinant Human ETV1
Supplier Creative Biomart
Catalog ETV1-28687TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P50549
Gene ETV1
Sequence LHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNTMVGSAASQSFPPPLMIK
Description Recombinant fragment of amino acids 148-257 Human ER81 with a proprietary tag at N-terminal, predicted MolWt 37.73 kDa including the tag,.
Supplier Page Shop