| Name | Active rat FGF2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200240 |
| Category | Protein |
| Prices | $101.00 |
| Sizes | 10 µg |
| Applications | FA HPLC SDS-PAGE |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 98 % by SDS-PAGE. Purity: >98% by SDS-PAGE and HPLC analyses. |
| Bioactivity | Fully biologically active when compared to standard. The ED 50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells is ≤ 0.2 ng/ml, corresponding to a specific activity of ≥5 x 10 6 units/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 10 to 154 |
| Sequence | PALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESN NYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |