Recombinant Human FBLN1

Name Recombinant Human FBLN1
Supplier Creative Biomart
Catalog FBLN1-28901TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P23142
Gene FBLN1
Sequence GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT
Description Recombinant fragment corresponding to amino acids 151-250 of Human Fibulin 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag.
Supplier Page Shop