Name | Recombinant Human FBLN1 |
---|---|
Supplier | Creative Biomart |
Catalog | FBLN1-28901TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P23142 |
Gene | FBLN1 |
Sequence | GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT |
Description | Recombinant fragment corresponding to amino acids 151-250 of Human Fibulin 1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa inclusive of tag. |
Supplier Page | Shop |