| Name | Active rat GM-CSF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab198565 |
| Category | Protein |
| Prices | $300.00 |
| Sizes | 20 µg |
| Applications | SDS-PAGE HPLC FA |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >= 97 % by SDS-PAGE. Protein Content and Purity (typically = 97%) determined by: UV spectroscopy at 280 nm. RP-HPLC calibrated against a known standard. Quantitation against a known standard via reducing and non-reducing SDS-PAGE gels. |
| Bioactivity | The activity is determined by the dose-dependent proliferation of mouse FDC-P1 cell line and is typically less than 100 pg/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P04141 |
| Gene | CSF2 |
| Residue | 18 to 144 |
| Sequence | MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSI QRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIE VTTFEDFIKNLKGFLFDIPFDCWKPVQK |
| Supplier Page | Shop |