Active rat GRO alpha full length protein

• Supplier: Abcam
• Catalog: ab192116
• Category: Protein
• Prices: $192.00
• Sizes: 25 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Rat
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: Determined by the ability to chemoattract Human neutrophils using a concentration range of 10-50 ng/ml.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P09341
• Gene: CXCL1
• Residue: 25 to 96
• Sequence: APVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREA CLDPEAPMVQKIVQKMLKGVPK