Recombinant Human FOXD2

Name Recombinant Human FOXD2
Supplier Creative Biomart
Catalog FOXD2-28109TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O60548
Gene FOXD2
Sequence SFSIDHIMGHGGGGAAPPGAGEGSPGPPFAAAAGPGGQAQVLAMLTAPALAPVAGHIRLSHPGDALLSSGSRFASKVAGLSGCH
Description Recombinant fragment of Human FOXD2 (amino acids 411-494) with a N terminal proprietary tag; Predicted MWt 34.87 kDa including the tag.
Supplier Page Shop