Recombinant Human FUCA1

Name Recombinant Human FUCA1
Supplier Creative Biomart
Catalog FUCA1-28956TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P04066
Gene FUCA1
Sequence EAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK
Description Recombinant fragment corresponding to amino acids 367-466 of Human FUCA1, with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusove of tag
Supplier Page Shop