Name | Recombinant Human FUCA1 |
---|---|
Supplier | Creative Biomart |
Catalog | FUCA1-28956TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | P04066 |
Gene | FUCA1 |
Sequence | EAIYASKPWRVQWEKNTTSVWYTSKGSAVYAIFLHWPENGVLNLESPITTSTTKITMLGIQGDLKWSTDPDKGLFISLPQLPPSAVPAEFAWTIKLTGVK |
Description | Recombinant fragment corresponding to amino acids 367-466 of Human FUCA1, with a N terminal proprietary tag; predicted MW: 36.63 kDa inclusove of tag |
Supplier Page | Shop |