Recombinant Human FZD2

Name Recombinant Human FZD2
Supplier Creative Biomart
Catalog FZD2-26287TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q14332
Gene FZD2
Sequence YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
Description Recombinant fragment corresponding to amino acids 192-245 of Human Frizzled 2 with an N terminal proprietary tag; predicted mwt: 31.57 kDa inclusive of tag.
Supplier Page Shop