Name | Recombinant Human FZD2 |
---|---|
Supplier | Creative Biomart |
Catalog | FZD2-26287TH |
Category | Protein |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q14332 |
Gene | FZD2 |
Sequence | YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR |
Description | Recombinant fragment corresponding to amino acids 192-245 of Human Frizzled 2 with an N terminal proprietary tag; predicted mwt: 31.57 kDa inclusive of tag. |
Supplier Page | Shop |