Name | Recombinant Human GABBR1 |
---|---|
Supplier | Creative Biomart |
Catalog | GABBR1-28091TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q9UBS5 |
Gene | GABBR1 |
Sequence | AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG |
Description | Recombinant fragment corresponding to amino acids 52-151 of Human GABA B Receptor 1 with a proprietary tag; Predicted MWt 36.63 kDa. |
Supplier Page | Shop |