Recombinant Human GATA6

Name Recombinant Human GATA6
Supplier Creative Biomart
Catalog GATA6-28981TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q92908
Gene GATA6
Sequence KNINKSKTCSGNSNNSIPMTPTSTSSNSDDCSKNTSPTTQPTASGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDSWCALALA
Description Recombinant fragment corresponding to amino acids 496-595 of Human Gata6 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop