Recombinant Human GGT1

Name Recombinant Human GGT1
Supplier Creative Biomart
Catalog GGT1-29021TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession P19440
Gene GGT1
Sequence TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG
Description Recombinant fragment corresponding to amino acids 381-470 of Human GGT1 with an N terminal proprietary tag; Predicted MWt 35.64 kDa.
Supplier Page Shop