Recombinant Human GRM8

Name Recombinant Human GRM8
Supplier Creative Biomart
Catalog GRM8-28274TH
Category Protein
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession O00222
Gene GRM8
Sequence KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
Description Recombinant fragment corresponding to amino acids 486-575 of Human Metabotropic Glutamate Receptor 8 with an N terminal proprietary tag; Predicted MWt 35.53 kDa.
Supplier Page Shop