Name | Recombinant Human HABP2 |
---|---|
Supplier | Creative Biomart |
Catalog | HABP2-28753TH |
Category | Protein |
Species Reactivities | Human |
Nature | Recombinant |
Source | Wheat germ |
Purity | Proprietary Purification |
SwissProt/Accession | Q14520 |
Gene | HABP2 |
Sequence | GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG |
Description | Recombinant fragment corresponding to amino acids 105-204 of Human HABP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
Supplier Page | Shop |