Recombinant Human HABP2

Name Recombinant Human HABP2
Supplier Creative Biomart
Catalog HABP2-28753TH
Category Protein
Species Reactivities Human
Nature Recombinant
Source Wheat germ
Purity Proprietary Purification
SwissProt/Accession Q14520
Gene HABP2
Sequence GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
Description Recombinant fragment corresponding to amino acids 105-204 of Human HABP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Supplier Page Shop